PDB entry 3gky

View 3gky on RCSB PDB site
Description: the structural basis of an er stress-associated bottleneck in a protein folding landscape
Deposited on 2009-03-11, released 2009-03-24
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Species: SUS SCROFA, synthetic [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
    • conflict (7)
    • conflict (15)
• Chain 'B':
  Compound: insulin B chain
  Species: SUS SCROFA, synthetic [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
• Chain 'C':
  Compound: insulin A chain
  Species: SUS SCROFA, synthetic [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
    • conflict (7)
    • conflict (15)
• Chain 'D':
  Compound: insulin B chain
  Species: SUS SCROFA, synthetic [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
• Heterogens: ZN, CL, IPH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3gkyA (A:)
  giveqcchsicslyqvenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >3gkyB (B:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >3gkyC (C:)
  giveqcchsicslyqvenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >3gkyD (D:)
  fvnqhlcgshlvealylvcgergffytpka