PDB entry 3gkv

View 3gkv on RCSB PDB site
Description: X-ray structure of an intermediate along the oxidation pathway of Trematomus bernacchii hemoglobin
Class: oxygen transport
Keywords: hemoglobin, intermediate quaternary structure,, Acetylation, Heme, Iron, Metal-binding, Oxygen transport, Transport
Deposited on 2009-03-11, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.184
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gkva_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gkvb_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gkvA (A:)
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gkvB (B:)
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh