PDB entry 3gk8

View 3gk8 on RCSB PDB site
Description: X-ray crystal structure of the Fab from MAb 14, mouse antibody against Canine Parvovirus
Class: immune system
Keywords: antibody fragment from neutralizing monoclonal antibody against canine parvovirus, IMMUNE SYSTEM
Deposited on 2009-03-10, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.266
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Fab 14 Heavy Chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3GK8 (0-219)
• Chain 'L':
  Compound: Fab 14 Light Chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3GK8 (0-213)
  Domains in SCOPe 2.06: d3gk8l1, d3gk8l2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gk8L (L:)
  divmtqshkfmstsvgdrvsitckasqdvntalawyqqipgqspklliysasnrytgvpd
  rftasgsgtdftftissvqaedlalyycqqhyttpwtfgggtkleikradaaptvsifpp
  sseqltsggasvvcflnnfypkdinvkwaidgaeraggvlnsftgqdskdstysmsstlt
  ltkdeyerhasytceathktstapivksfnrgaa