PDB entry 3gk3

View 3gk3 on RCSB PDB site
Description: Crystal structure of acetoacetyl-CoA reductase from Burkholderia pseudomallei 1710b
Class: oxidoreductase
Keywords: acetoacetyl-Co reductase, Oxidoreductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-03-09, released 2009-03-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.228
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetoacetyl-CoA reductase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: phbB-2, BURPS1710b_A1014
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3gk3a_
  • Chain 'B':
    Compound: Acetoacetyl-CoA reductase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: phbB-2, BURPS1710b_A1014
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3gk3b_
  • Chain 'C':
    Compound: Acetoacetyl-CoA reductase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: phbB-2, BURPS1710b_A1014
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3gk3c_
  • Chain 'D':
    Compound: Acetoacetyl-CoA reductase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: phbB-2, BURPS1710b_A1014
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3gk3d_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gk3A (A:)
    mahhhhhhmgtleaqtqgpgsmqakrvafvtggmgglgaaisrrlhdagmavavshsern
    dhvstwlmherdagrdfkayavdvadfescercaekvladfgkvdvlinnagitrdatfm
    kmtkgdwdavmrtdldamfnvtkqfiagmverrfgrivnigsvngsrgafgqanyasaka
    gihgftktlaletakrgitvntvspgylatamveavpqdvleakilpqipvgrlgrpdev
    aaliaflcsddagfvtgadlainggmhms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk3A (A:)
    akrvafvtggmgglgaaisrrlhdagmavavshserndhvstwlmherdagrdfkayavd
    vadfescercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtk
    qfiagmverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntv
    spgylatamveaakilpqipvgrlgrpdevaaliaflcsddagfvtgadlainggmhms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gk3B (B:)
    mahhhhhhmgtleaqtqgpgsmqakrvafvtggmgglgaaisrrlhdagmavavshsern
    dhvstwlmherdagrdfkayavdvadfescercaekvladfgkvdvlinnagitrdatfm
    kmtkgdwdavmrtdldamfnvtkqfiagmverrfgrivnigsvngsrgafgqanyasaka
    gihgftktlaletakrgitvntvspgylatamveavpqdvleakilpqipvgrlgrpdev
    aaliaflcsddagfvtgadlainggmhms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk3B (B:)
    akrvafvtggmgglgaaisrrlhdagmavavshsdhvstwlmherdagrdfkayavdvad
    fescercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtkqfi
    agmverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntvspg
    ylatamveavpqdvleakilpqipvgrlgrpdevaaliaflcsddagfvtgadlainggm
    hms
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gk3C (C:)
    mahhhhhhmgtleaqtqgpgsmqakrvafvtggmgglgaaisrrlhdagmavavshsern
    dhvstwlmherdagrdfkayavdvadfescercaekvladfgkvdvlinnagitrdatfm
    kmtkgdwdavmrtdldamfnvtkqfiagmverrfgrivnigsvngsrgafgqanyasaka
    gihgftktlaletakrgitvntvspgylatamveavpqdvleakilpqipvgrlgrpdev
    aaliaflcsddagfvtgadlainggmhms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk3C (C:)
    akrvafvtggmgglgaaisrrlhdagmavavshserndhvstwlmherdagrdfkayavd
    vadfescercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtk
    qfiagmverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntv
    spgylatamvakilpqipvgrlgrpdevaaliaflcsddagfvtgadlainggmhms
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gk3D (D:)
    mahhhhhhmgtleaqtqgpgsmqakrvafvtggmgglgaaisrrlhdagmavavshsern
    dhvstwlmherdagrdfkayavdvadfescercaekvladfgkvdvlinnagitrdatfm
    kmtkgdwdavmrtdldamfnvtkqfiagmverrfgrivnigsvngsrgafgqanyasaka
    gihgftktlaletakrgitvntvspgylatamveavpqdvleakilpqipvgrlgrpdev
    aaliaflcsddagfvtgadlainggmhms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk3D (D:)
    akrvafvtggmgglgaaisrrlhdagmavavshsvstwlmherdagrdfkayavdvadfe
    scercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtkqfiag
    mverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntvspgyl
    atamveavpqdvleakilpqipvgrlgrpdevaaliaflcsddagfvtgadlainggmhm
    s