PDB entry 3gk2

View 3gk2 on RCSB PDB site
Description: X-ray structure of bovine SBi279,Ca(2+)-S100B
Class: metal binding protein
Keywords: EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2009-03-09, released 2009-06-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.229
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3gk2a_
  • Heterogens: CA, 27A, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3gk2A (A:)
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffehe

    Sequence, based on observed residues (ATOM records): (download) 
    >3gk2A (A:)
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheff