PDB entry 3gk1

View 3gk1 on RCSB PDB site
Description: X-ray structure of bovine SBi132,Ca(2+)-S100B
Class: metal binding protein
Keywords: EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2009-03-09, released 2009-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gk1a_
  • Heterogens: CA, 32A, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gk1A (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk1A (A:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheff