PDB entry 3gk0

View 3gk0 on RCSB PDB site
Description: Crystal structure of pyridoxal phosphate biosynthetic protein from Burkholderia pseudomallei
Class: transferase
Keywords: deCODE, SSGCID, NIAID, SBRI, Pyridoxine biosynthesis, Transferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2009-03-09, released 2009-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0a_
  • Chain 'B':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0b_
  • Chain 'C':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0c_
  • Chain 'D':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0d_
  • Chain 'E':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0e_
  • Chain 'F':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0f_
  • Chain 'G':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0g_
  • Chain 'H':
    Compound: pyridoxine 5'-phosphate synthase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: PDXJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gk0h_
  • Heterogens: PO4, DXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gk0A (A:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0A (A:)
    fflttpaaidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivd
    advrtlrprvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfda
    vraackqladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferi
    atgvdagialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremk
    aimvaarvaalh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gk0B (B:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0B (B:)
    fflttpaaidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivd
    advrtlrprvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfda
    vraackqladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferi
    atgvdagialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremk
    aimvaarvaalh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gk0C (C:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0C (C:)
    aidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtlr
    prvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraackq
    ladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvdag
    ialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaar
    vaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gk0D (D:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0D (D:)
    aaidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtl
    rprvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraack
    qladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvda
    gialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaa
    rvaalh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3gk0E (E:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0E (E:)
    aidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtlr
    prvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraackq
    ladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvdag
    ialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaar
    vaalh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3gk0F (F:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0F (F:)
    aidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtlr
    prvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraackq
    ladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvdag
    ialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaar
    vaal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3gk0G (G:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0G (G:)
    aidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtlr
    prvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraackq
    ladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvdag
    ialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaar
    vaalh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3gk0H (H:)
    mahhhhhhmgtleaqtqgpgsmsfflttpaaidlgvnidhvatlrnargtaypdpvraal
    aaedagadaitlhlredrrhivdadvrtlrprvktrmnlecavtpemldiaceirphdac
    lvpekrseltteggldvvghfdavraackqladagvrvslfidpdeaqiraahetgapvi
    elhtgryadahdaaeqqreferiatgvdagialglkvnaghglhytnvqaiaalpgiael
    nighaivahavfvgwdnavremkaimvaarvaalhggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gk0H (H:)
    aaidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtl
    rprvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraack
    qladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvda
    gialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaa
    rvaalh