PDB entry 3gjx

View 3gjx on RCSB PDB site
Description: Crystal Structure of the Nuclear Export Complex CRM1-Snurportin1-RanGTP
Class: protein transport
Keywords: Transport, Cytoplasm, Nucleus, RNA-binding, Acetylation, GTP-binding, Host-virus interaction, Nucleotide-binding, Phosphoprotein, Polymorphism, Protein transport, mRNA transport
Deposited on 2009-03-09, released 2009-05-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.246
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exportin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Xpo1, Crm1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNUPN, RNUT1, SPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95149 (5-364)
      • expression tag (3-4)
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered (68)
    Domains in SCOPe 2.03: d3gjxc_
  • Chain 'D':
    Compound: Exportin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Xpo1, Crm1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNUPN, RNUT1, SPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95149 (5-364)
      • expression tag (2-4)
  • Chain 'F':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered (68)
    Domains in SCOPe 2.03: d3gjxf_
  • Heterogens: NA, GTP, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gjxC (C:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gjxC (C:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    lekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3gjxF (F:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gjxF (F:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    lekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam