PDB entry 3gjc

View 3gjc on RCSB PDB site
Description: Crystal Structure of the E290S mutant of LeuT with bound OG
Class: transport protein
Keywords: Transmembrane transport, neurotransmitter:sodium symport, Sodium-coupled transport, NSS, aminoacid transport, Symport, Transmembrane, Transport, TRANSPORT PROTEIN
Deposited on 2009-03-08, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transporter
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_2077, snf
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854
      • engineered (289)
    Domains in SCOPe 2.08: d3gjca_
  • Chain 'B':
    Compound: Transporter
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_2077, snf
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854
      • engineered (289)
    Domains in SCOPe 2.08: d3gjcb_
  • Heterogens: NA, LEU, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gjcA (A:)
    mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaim
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gjcA (A:)
    vkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwie
    wamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikf
    lvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsi
    lirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpg
    vwiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisipaa
    vaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqp
    miafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltelii
    ffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareeethwtvwitrf
    yiiglflfltflvflaer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gjcB (B:)
    mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaim
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gjcB (B:)
    vkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwie
    wamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikf
    lvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsi
    lirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpg
    vwiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisipaa
    vaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqp
    miafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltelii
    ffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareeethwtvwitrf
    yiiglflfltflvflaer