PDB entry 3gj6

View 3gj6 on RCSB PDB site
Description: Crystal structure of human RanGDP-Nup153ZnF1 complex
Class: transport protein
Keywords: G protein, GDP, Ran, Nuclear Pore, Nup153, Zinc Finger, Acetylation, Cytoplasm, GTP-binding, Host-virus interaction, Isopeptide bond, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Protein transport, Transport, Ubl conjugation, DNA-binding, Metal-binding, mRNA transport, Nuclear pore complex, Translocation, Zinc, Zinc-finger, TRANSPORT PROTEIN
Deposited on 2009-03-07, released 2009-08-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered (39)
    Domains in SCOPe 2.06: d3gj6a_
  • Chain 'B':
    Compound: Nuclear pore complex protein Nup153
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NUP153
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GDP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gj6A (A:)
    gphmasaaqgepqvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtn
    rgpikfnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvceni
    pivlcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnle
    fvampalappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gj6A (A:)
    epqvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtnrgpikfnvwd
    tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
    ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
    evvmdpalaaqyehdlevaqtta
    

  • Chain 'B':
    No sequence available.