PDB entry 3gik

View 3gik on RCSB PDB site
Description: Dpo4 extension ternary complex with the oxoG(anti)-C(anti) pair
Deposited on 2009-03-05, released 2009-05-19
The last revision was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: Sulfolobus solfataricus P2 [TaxId:273057]
    Gene: DBH, DPO4, SSO2448
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97W02 (1-340)
      • expression tag (0)
  • Chain 'D':
    Compound: 5'-d(*gp*tp*tp*gp*gp*ap*tp*gp*gp*tp*ap*gp*(doc))-3'
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: 5'-d(*cp*tp*ap*ap*cp*(8og)p*cp*tp*ap*cp*cp*ap*tp*cp*cp*ap*ap*c)-3'
    Species: synthetic, synthetic
  • Heterogens: DGT, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3gikA (A:)
givlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.