PDB entry 3gi6

View 3gi6 on RCSB PDB site
Description: Crystal structure of protease inhibitor, AD78 in complex with wild type HIV-1 protease
Class: hydrolase/hydrolase inhibitor
Keywords: Drug design, protease inhibitors, HIV-1 protease, Aspartyl protease, Hydrolase, Protease, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2009-03-05, released 2010-03-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.166
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered (6)
  Domains in SCOPe 2.05: d3gi6a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered (6)
  Domains in SCOPe 2.05: d3gi6b_
• Heterogens: D78, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gi6A (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gi6B (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf