PDB entry 3gi3

View 3gi3 on RCSB PDB site
Description: Crystal structure of a N-Phenyl-N'-Naphthylurea analog in complex with p38 MAP kinase
Class: transferase
Keywords: two lobe kinase structure, N-lobe beta-sheet, C-lobe alpha-helix, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2009-03-05, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • conflict (47)
      • conflict (169)
    Domains in SCOPe 2.06: d3gi3a_
  • Heterogens: B10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gi3A (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfylarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gi3A (A:)
    rptfyrqelnktiwevperyqnlspvsvcaafdtktghrvavkklsrpfqsiihakrtyr
    elrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvqfl
    iyqilrglkyihsadiihrdlkpsnlavnedcelkildfyvatrwyrapeimlnwmhynq
    tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
    tqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadp
    ydqsfesrdllidewksltydevisfvppp