PDB entry 3ghj

View 3ghj on RCSB PDB site
Description: crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4
Deposited on 2009-03-03, released 2009-03-24
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGV9 (22-140)
      • expression tag (0-21)
      • engineered mutation (117)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ghjA (A:)
mgsshhhhhhssgrenlyfqgvpmnikglfevavkvknlekssqfyteilgfeaglldsa
rrwnflwvsgragmvvlqeekenwqqqhfsfrvekseieplkkaleskgvsvhgpvnqew
mqavslyfadpnghaleftal

    Sequence, based on observed residues (ATOM records):
    >3ghjA (A:)
ikglfevavkvknlekssqfyteilgfeaglldsarrwnflwvsgragmvvlqeekenwq
qqhfsfrvekseieplkkaleskgvsvhgpvnqewmqavslyfadpnghaleftal