PDB entry 3ghg

View 3ghg on RCSB PDB site
Description: Crystal Structure of Human Fibrinogen
Class: blood clotting
Keywords: triple-stranded coiled coil, beta sheets, alpha helices, Amyloid, Amyloidosis, Blood coagulation, Disease mutation, Glycoprotein, Phosphoprotein, Secreted, Pyrrolidone carboxylic acid, Sulfation, BLOOD CLOTTING
Deposited on 2009-03-03, released 2009-05-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.255
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ghga_
  • Chain 'B':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ghgd_
  • Chain 'E':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ghgg_
  • Chain 'H':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: fibrinogen alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ghgj_
  • Chain 'K':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: A knob
  • Chain 'N':
    Compound: A knob
  • Chain 'O':
    Compound: B knob
  • Chain 'P':
    Compound: B knob
  • Chain 'Q':
    Compound: A knob
  • Chain 'R':
    Compound: A knob
  • Chain 'S':
    Compound: B knob
  • Chain 'T':
    Compound: B knob
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ghgA (A:)
    adsgegdflaegggvrgprvverhqsackdsdwpfcsdedwnykcpsgcrmkglidevnq
    dftnrinklknslfeyqknnkdshslttnimeilrgdfssannrdntynrvsedlrsrie
    vlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyed
    qqkqleqviakdllpsrdrqhlplikmkpvpdlvpgnfksqlqkvppewkaltdmpqmrm
    elerpggneitrggstsygtgsetesprnpssagswnsgssgpgstgnrnpgssgtggta
    twkpgssgpgstgswnsgssgtgstgnqnpgsprpgstgtwnpgssergsaghwtsessv
    sgstgqwhsesgsfrpdspgsgnarpnnpdwgtfeevsgnvspgtrreyhteklvtskgd
    kelrtgkekvtsgsttttrrscsktvtktvigpdghkevtkevvtsedgsdcpeamdlgt
    lsgigtldgfrhrhpdeaaffdtastgktfpgffspmlgefvsetesrgsesgiftntke
    ssshhpgiaefpsrgksssysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ghgA (A:)
    ackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknslfeyqknnkdshsl
    ttnimeilrgdfssannrdntynrvsedlrsrievlkrkviekvqhiqllqknvraqlvd
    mkrlevdidikirscrgscsralarevdlkdyedqqkqleqviakdllpsrdrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ghgD (D:)
    adsgegdflaegggvrgprvverhqsackdsdwpfcsdedwnykcpsgcrmkglidevnq
    dftnrinklknslfeyqknnkdshslttnimeilrgdfssannrdntynrvsedlrsrie
    vlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyed
    qqkqleqviakdllpsrdrqhlplikmkpvpdlvpgnfksqlqkvppewkaltdmpqmrm
    elerpggneitrggstsygtgsetesprnpssagswnsgssgpgstgnrnpgssgtggta
    twkpgssgpgstgswnsgssgtgstgnqnpgsprpgstgtwnpgssergsaghwtsessv
    sgstgqwhsesgsfrpdspgsgnarpnnpdwgtfeevsgnvspgtrreyhteklvtskgd
    kelrtgkekvtsgsttttrrscsktvtktvigpdghkevtkevvtsedgsdcpeamdlgt
    lsgigtldgfrhrhpdeaaffdtastgktfpgffspmlgefvsetesrgsesgiftntke
    ssshhpgiaefpsrgksssysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ghgD (D:)
    ackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknslfeyqknnkdshsl
    ttnimeilrgdfssannrdntynrvsedlrsrievlkrkviekvqhiqllqknvraqlvd
    mkrlevdidikirscrgscsralarevdlkdyedqqkqleqviakdllpsrdrq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ghgG (G:)
    adsgegdflaegggvrgprvverhqsackdsdwpfcsdedwnykcpsgcrmkglidevnq
    dftnrinklknslfeyqknnkdshslttnimeilrgdfssannrdntynrvsedlrsrie
    vlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyed
    qqkqleqviakdllpsrdrqhlplikmkpvpdlvpgnfksqlqkvppewkaltdmpqmrm
    elerpggneitrggstsygtgsetesprnpssagswnsgssgpgstgnrnpgssgtggta
    twkpgssgpgstgswnsgssgtgstgnqnpgsprpgstgtwnpgssergsaghwtsessv
    sgstgqwhsesgsfrpdspgsgnarpnnpdwgtfeevsgnvspgtrreyhteklvtskgd
    kelrtgkekvtsgsttttrrscsktvtktvigpdghkevtkevvtsedgsdcpeamdlgt
    lsgigtldgfrhrhpdeaaffdtastgktfpgffspmlgefvsetesrgsesgiftntke
    ssshhpgiaefpsrgksssysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ghgG (G:)
    ackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknslfeyqknnkdshsl
    ttnimeilrgdfssannrdntynrvsedlrsrievlkrkviekvqhiqllqknvraqlvd
    mkrlevdidikirscrgscsralarevdlkdyedqqkqleqviakdllpsrdrq
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ghgJ (J:)
    adsgegdflaegggvrgprvverhqsackdsdwpfcsdedwnykcpsgcrmkglidevnq
    dftnrinklknslfeyqknnkdshslttnimeilrgdfssannrdntynrvsedlrsrie
    vlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyed
    qqkqleqviakdllpsrdrqhlplikmkpvpdlvpgnfksqlqkvppewkaltdmpqmrm
    elerpggneitrggstsygtgsetesprnpssagswnsgssgpgstgnrnpgssgtggta
    twkpgssgpgstgswnsgssgtgstgnqnpgsprpgstgtwnpgssergsaghwtsessv
    sgstgqwhsesgsfrpdspgsgnarpnnpdwgtfeevsgnvspgtrreyhteklvtskgd
    kelrtgkekvtsgsttttrrscsktvtktvigpdghkevtkevvtsedgsdcpeamdlgt
    lsgigtldgfrhrhpdeaaffdtastgktfpgffspmlgefvsetesrgsesgiftntke
    ssshhpgiaefpsrgksssysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ghgJ (J:)
    ackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknslfeyqknnkdshsl
    ttnimeilrgdfssannrdntynrvsedlrsrievlkrkviekvqhiqllqknvraqlvd
    mkrlevdidikirscrgscsralarevdlkdyedqqkqleqviakdllpsrdrqhlplik
    mkpvpd
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.