PDB entry 3ghf

View 3ghf on RCSB PDB site
Description: crystal structure of the septum site-determining protein minc from salmonella typhimurium
Deposited on 2009-03-03, released 2009-03-24
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: septum site-determining protein minc
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: minC, STM1814
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ghfA (A:)
mslsntpielkgssftlsvvhlheaepevirqaledkiaqapaflkhapvvinvsglesp
vnwpelhkivtstglriigvsgckdaslkveidrmglplltegkekavrpapeghhhhhh

    Sequence, based on observed residues (ATOM records):
    >3ghfA (A:)
pielkgssftlsvvhlheaepevirqaledkiaqapaflkhapvvinvsglespvnwpel
hkivtstglriigvsgckdaslkveidrmglplltegkek