PDB entry 3ghc

View 3ghc on RCSB PDB site
Description: Design, Synthesis, and X-ray Crystal Structure of Classical and Nonclassical 2-amino-4-oxo-5-substituted-6-thieno[2,3-d]pyrimidines as dual thymidylate synthase and dihydrofolate reductase inhibitors and as potential antitumor agenst
Class: oxidoreductase
Keywords: protein inhibitor complex folate analogues, NADP, One-carbon metabolism, Oxidoreductase
Deposited on 2009-03-03, released 2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.171
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: DHFR, DHFRP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00374 (0-185)
      • engineered (34)
      • engineered (63)
    Domains in SCOPe 2.08: d3ghca_
  • Heterogens: GHC, NDP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ghcA (A:)
vgslncivavsqnmgigkngdlpwpplrnefryfsrmtttssvegkqnlvimgkktwfsi
peksrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd