PDB entry 3ggl

View 3ggl on RCSB PDB site
Description: X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A.
Deposited on 2009-02-28, released 2009-03-31
The last revision was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.202
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative chitobiase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_0865
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gglA (A:)
dtytgfciikegtkisksgwevlsfttqeasgegagnglakclidgdtetfwhakwqggs
dplpydividmkqniqiaqvellprgrgsnnpikvvefaasednvnwtpigrfgftnqda
aleyyvksikaryirltipddggnstvaaireldvkgtiinlehhhhhh

    Sequence, based on observed residues (ATOM records):
    >3gglA (A:)
dtytgfciikegtkisksgwevlsfttqeasgegagnglakclidgdtetfwhakwqggs
dplpydividmkqniqiaqvellprgrgsnnpikvvefaasednvnwtpigrfgftnqda
aleyyvksikaryirltipddggnstvaaireldvkgtiin