PDB entry 3gge

View 3gge on RCSB PDB site
Description: crystal structure of the pdz domain of pdz domain-containing protein gipc2
Deposited on 2009-02-27, released 2009-03-24
The last revision was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PDZ domain-containing protein GIPC2
    Species: Homo sapiens [TaxId:9606]
    Gene: GIPC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TF65 (2-90)
      • expression tag (0-1)
      • expression tag (91-94)
  • Chain 'B':
    Compound: PDZ domain-containing protein GIPC2
    Species: Homo sapiens [TaxId:9606]
    Gene: GIPC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TF65 (Start-90)
      • expression tag (91-94)
  • Chain 'C':
    Compound: PDZ domain-containing protein GIPC2
    Species: Homo sapiens [TaxId:9606]
    Gene: GIPC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TF65 (2-90)
      • expression tag (0-1)
      • expression tag (91-94)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ggeA (A:)
smkgiekevnvyksedslgltitdngvgyafikrikdggvidsvkticvgdhiesingen
ivgwrhydvakklkelkkeelftmkliepkkssea

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ggeB (B:)
smkgiekevnvyksedslgltitdngvgyafikrikdggvidsvkticvgdhiesingen
ivgwrhydvakklkelkkeelftmkliepkkssea

    Sequence, based on observed residues (ATOM records):
    >3ggeB (B:)
giekevnvyksedslgltitdngvgyafikrikdggvidsvkticvgdhiesingenivg
wrhydvakklkelkkeelftmkliepkkssea

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3ggeC (C:)
smkgiekevnvyksedslgltitdngvgyafikrikdggvidsvkticvgdhiesingen
ivgwrhydvakklkelkkeelftmkliepkkssea