PDB entry 3gfr

View 3gfr on RCSB PDB site
Description: Structure of YhdA, D137L variant
Class: oxidoreductase
Keywords: FLAVOPROTEINS, QUINONE REDUCTASE, FLAVODOXIN, OLIGOMERIZATION, Flavoprotein, FMN, NADP, Oxidoreductase
Deposited on 2009-02-27, released 2009-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent NADPH-azoreductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: azr, BSU09340, yhdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07529
      • engineered (136)
    Domains in SCOPe 2.04: d3gfra_
  • Chain 'B':
    Compound: FMN-dependent NADPH-azoreductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: azr, BSU09340, yhdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07529
      • engineered (136)
    Domains in SCOPe 2.04: d3gfrb_
  • Chain 'C':
    Compound: FMN-dependent NADPH-azoreductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: azr, BSU09340, yhdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07529
      • engineered (136)
    Domains in SCOPe 2.04: d3gfrc_
  • Chain 'D':
    Compound: FMN-dependent NADPH-azoreductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: azr, BSU09340, yhdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07529 (Start-173)
      • engineered (136)
    Domains in SCOPe 2.04: d3gfrd_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gfrA (A:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfakagnpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfrA (A:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gfrB (B:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfakagnpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfrB (B:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gfrC (C:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfakagnpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfrC (C:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gfrD (D:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfakagnpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfrD (D:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvllpvhidvenatvaenikesikelveelsmfakagnpgv