PDB entry 3gfp

View 3gfp on RCSB PDB site
Description: Structure of the C-terminal domain of the DEAD-box protein Dbp5
Class: hydrolase
Keywords: mRNA export, ATPase, RecA-fold, ATP-binding, Helicase, Hydrolase, Membrane, mRNA transport, Nuclear pore complex, Nucleotide-binding, Nucleus, Phosphoprotein, Protein transport, RNA-binding, Translocation, Transport
Deposited on 2009-02-27, released 2009-09-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DEAD box protein 5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DBP5, RAT8, YOR046C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3gfpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gfpA (A:)
    gatnevnvdaikqlymdckneadkfdvltelyglmtigssiifvatkktanvlygklkse
    ghevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlang
    qadpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdeve
    kivkkvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfpA (A:)
    nvdaikqlymdckneadkfdvltelyglmtigssiifvatkktanvlygklkseghevsi
    lhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangqadpat
    yihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevekivkkv