PDB entry 3gfl

View 3gfl on RCSB PDB site
Description: crystal structure of the st1710 mutant (r90a) protein
Deposited on 2009-02-27, released 2009-08-25
The last revision was dated 2021-11-10, with a file datestamp of 2021-11-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 146aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1710
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96ZY1 (0-145)
      • engineered mutation (89)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gflA (A:)
mlesnenriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanry
fvtqsaitasvdkleemglvvrvrdredrakilieitekgletfnkgieiykklanevtg
dlsedevilvldkiskilkrieeisq

    Sequence, based on observed residues (ATOM records):
    >3gflA (A:)
enriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanryfvtqs
aitasvdkleemglvvrvrdredrakilieitekgletfnkgieiykklanevtgdlsed
evilvldkiskilkrieeisq