PDB entry 3gfc

View 3gfc on RCSB PDB site
Description: Crystal Structure of Histone-binding protein RBBP4
Class: transcription
Keywords: RBBP4, Histone-binding protein, Structural Genomics, Structural Genomics Consortium, SGC, Cell cycle, Chromatin regulator, DNA replication, Nucleus, Repressor, Transcription, Transcription regulation, WD repeat
Deposited on 2009-02-26, released 2009-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-binding protein RBBP4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBBP4, RBAP48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gfca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gfcA (A:)
    madkeaafddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkd
    fsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvsgkieieik
    inhegevnrarympqnpciiatktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkeg
    yglswnpnlsghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllhe
    slfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktval
    wdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigeeqspedae
    dgppellfihgghtakisdfswnpnepwvicsvsednimqvwqmaeniyndedpegsvdp
    egqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gfcA (A:)
    wkkntpflydlvmthalewpsltaqwlpdvtdfsihrlvlgthtqnhlviasvqlpnkie
    ieikinhegevnrarympqnpciiatktpssdvlvfdytkhpskpdcnpdlrlrghqkeg
    yglswnpnlsghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllhe
    slfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktval
    wdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigppellfihg
    ghtakisdfswnpnepwvicsvsednimqvwqmaeniyn