PDB entry 3gf3

View 3gf3 on RCSB PDB site
Description: Glutaconyl-coA decarboxylase A subunit from Clostridium symbiosum co-crystallized with glutaconyl-coA
Class: lyase
Keywords: glutaconyl-CoA decarboxylase, sodium ion transport, biotin, glutamate fermentation, LYASE
Deposited on 2009-02-26, released 2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.163
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaconyl-CoA decarboxylase subunit A
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: GCDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gf3a1, d3gf3a2
  • Heterogens: COO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gf3A (A:)
    mnmysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnerg
    qlsamqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmag
    awvpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnq
    lgipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqi
    iaaqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpaynleffrvd
    tpkapqlpaedlysiipmnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngl
    lvgvianvqgllmnypeykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgi
    dvgdeaekaellglgqsliysiensklpsleitirkasaaahyvlggpqgnntnvfsigt
    gaceyyvmpgetaanamysrklvkakkagedlqpiigkmndmiqmytdksrpkyctekgm
    vdeivdmtevrpyiqafteaayqnpqsicpmhqmltprstrefetfgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gf3A (A:)
    mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql
    samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw
    vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg
    ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs
    vpihydetgffrevyqndlgvidgikkyisylpaynleffrvdtpkapqlpaedlysiip
    mnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngllvgvianvqgllmnype
    ykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgidvgdeaekaellglgqs
    liysiensklpsleitirkasaaahyvlggpqgnntnvfsigtgaceyyvmpgetaanam
    ysrklvkaqpiigkmndmiqmytdksrpkyctekgmvdeivdmtevrpyiqafteaayqn
    pqsicpmhqmltprstrefetfg