PDB entry 3gf2

View 3gf2 on RCSB PDB site
Description: crystal structure of the hypothetical regulator st1710 complexed with sodium salicylate
Deposited on 2009-02-26, released 2009-08-25
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 146aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1710
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gf2A (A:)
mlesnenriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanry
fvtqsaitasvdkleemglvvrvrdredrrkilieitekgletfnkgieiykklanevtg
dlsedevilvldkiskilkrieeisq

    Sequence, based on observed residues (ATOM records):
    >3gf2A (A:)
enriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanryfvtqs
aitasvdkleemglvvrvrdredrrkilieitekgletfnkgieiykklanevtgdlsed
evilvldkiskilkrieeisq