PDB entry 3gf1

View 3gf1 on RCSB PDB site
Description: solution structure of human insulin-like growth factor 1: a nuclear magnetic resonance and restrained molecular dynamics study
Class: growth factor
Keywords: growth factor
Deposited on 1991-01-24, released 1993-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin-like growth factor I
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01343 (0-69)
  Domains in SCOPe 2.07: d3gf1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gf1A (A:)
  gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
  caplkpaksa