PDB entry 3get

View 3get on RCSB PDB site
Description: Crystal structure of putative histidinol-phosphate aminotransferase (NP_281508.1) from Campylobacter jejuni at 2.01 A resolution
Class: transferase
Keywords: NP_281508.1, putative histidinol-phosphate aminotransferase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Amino-acid biosynthesis, Aminotransferase, Histidine biosynthesis, Pyridoxal phosphate, Transferase
Deposited on 2009-02-26, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Campylobacter jejuni subsp. jejuni NCTC 11168 [TaxId:192222]
    Gene: Cj0317, hisC, NP_281508.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PII2 (1-364)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3geta1, d3geta2
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: Campylobacter jejuni subsp. jejuni NCTC 11168 [TaxId:192222]
    Gene: Cj0317, hisC, NP_281508.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3getb_
  • Heterogens: IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3getA (A:)
    gmkfneflnnlsnyepgkdieviakeygvkeviklasnenpfgtppkaieclrqnankah
    lypddsmielkstlaqkykvqneniiigagsdqviefaihsklnsknaflqagvtfamye
    iyakqcgakcyktqsithnldefkklyethkdeikliflclpnnplgecldaseatefik
    gvnedclvvidaaynefasfkdskkhlepcelikefdnvlylgtfsklyglgglrigygi
    ananiisafyklrapfnvsnlalkaavaamdddeftektlennfsqmelykefakkhnik
    iidsytnfityffdeknstdlsekllkkgiiirnlksyglnairitigtsyenekfftef
    dkilr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3getB (B:)
    gmkfneflnnlsnyepgkdieviakeygvkeviklasnenpfgtppkaieclrqnankah
    lypddsmielkstlaqkykvqneniiigagsdqviefaihsklnsknaflqagvtfamye
    iyakqcgakcyktqsithnldefkklyethkdeikliflclpnnplgecldaseatefik
    gvnedclvvidaaynefasfkdskkhlepcelikefdnvlylgtfsklyglgglrigygi
    ananiisafyklrapfnvsnlalkaavaamdddeftektlennfsqmelykefakkhnik
    iidsytnfityffdeknstdlsekllkkgiiirnlksyglnairitigtsyenekfftef
    dkilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3getB (B:)
    mkfneflnnlsnyedieviakeygvkeviklasnenpfgtppkaieclrqnankahlypd
    dsmielkstlaqkykvqneniiigagsdqviefaihsklnsknaflqagvtfamyeiyak
    qcgakcyktqsithnldefkklyethkdeikliflclpnnplgecldaseatefikgvne
    dclvvidaaynefasfkdskkhlepcelikefdnvlylgtfsklyglgglrigygianan
    iisafyklrapfnvsnlalkaavaamdddeftektlennfsqmelykefakkhnikiids
    ytnfityffdeknstdlsekllkkgiiirnlksyglnairitigtsyenekfftefdkil
    r