PDB entry 3gen

View 3gen on RCSB PDB site
Description: The 1.6 A crystal structure of human bruton's tyrosine kinase bound to a pyrrolopyrimidine-containing compound
Class: transferase
Keywords: Bruton's tyrosine kinase, 4-Amino-5-(4-phenoxyphenyl)-5H-pyrrolo[3, 2-d]pyrimidin-7-yl-cyclopentane, TEC-family, complex, Acetylation, ATP-binding, Cytoplasm, Disease mutation, Kinase, Membrane, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Zinc, Zinc-finger
Deposited on 2009-02-25, released 2010-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.195
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: AGMX1, ATK, BPK, BTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gena_
  • Heterogens: B43, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3genA (A:)
    gplgsknapstaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegs
    msedefieeakvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtq
    qllemckdvceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvg
    skfpvrwsppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrl
    yrphlasekvytimyscwhekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3genA (A:)
    ygsweidpkdltflkelgfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
    eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
    kqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskf
    ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscw
    hekaderptfkillsnildvmdee