PDB entry 3gef
View 3gef on RCSB PDB site
Description: Crystal structure of the R482W mutant of lamin A/C
Class: structural protein
Keywords: immunoglobulin fold, lamin, Cardiomyopathy, Charcot-Marie-Tooth disease, Disease mutation, Intermediate filament, Limb-girdle muscular dystrophy, Lipoprotein, Nucleus, Phosphoprotein, Prenylation, STRUCTURAL PROTEIN
Deposited on
2009-02-25, released
2009-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2014-11-19, with a file datestamp of
2014-11-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.214
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Lamin-A/C
Species: Homo sapiens [TaxId:9606]
Gene: Lamin A/C 435-552, LMN1, LMNA
Database cross-references and differences (RAF-indexed):
- Uniprot P02545 (1-117)
- expression tag (0)
- engineered (47)
Domains in SCOPe 2.08: d3gefa1, d3gefa2 - Chain 'B':
Compound: Lamin-A/C
Species: Homo sapiens [TaxId:9606]
Gene: Lamin A/C 435-552, LMN1, LMNA
Database cross-references and differences (RAF-indexed):
- Uniprot P02545 (1-117)
- expression tag (0)
- engineered (47)
Domains in SCOPe 2.08: d3gefb1, d3gefb2 - Chain 'C':
Compound: Lamin-A/C
Species: Homo sapiens [TaxId:9606]
Gene: Lamin A/C 435-552, LMN1, LMNA
Database cross-references and differences (RAF-indexed):
- Uniprot P02545 (1-117)
- expression tag (0)
- engineered (47)
Domains in SCOPe 2.08: d3gefc1, d3gefc2 - Chain 'D':
Compound: Lamin-A/C
Species: Homo sapiens [TaxId:9606]
Gene: Lamin A/C 435-552, LMN1, LMNA
Database cross-references and differences (RAF-indexed):
- Uniprot P02545 (1-117)
- expression tag (0)
- engineered (47)
Domains in SCOPe 2.08: d3gefd1, d3gefd2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3gefA (A:)
stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3gefB (B:)
stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3gefC (C:)
stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3gefD (D:)
stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved