PDB entry 3gef

View 3gef on RCSB PDB site
Description: Crystal structure of the R482W mutant of lamin A/C
Class: structural protein
Keywords: immunoglobulin fold, lamin, Cardiomyopathy, Charcot-Marie-Tooth disease, Disease mutation, Intermediate filament, Limb-girdle muscular dystrophy, Lipoprotein, Nucleus, Phosphoprotein, Prenylation, STRUCTURAL PROTEIN
Deposited on 2009-02-25, released 2009-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.214
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lamin-A/C
    Species: Homo sapiens [TaxId:9606]
    Gene: Lamin A/C 435-552, LMN1, LMNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02545 (1-117)
      • expression tag (0)
      • engineered (47)
    Domains in SCOPe 2.08: d3gefa1, d3gefa2
  • Chain 'B':
    Compound: Lamin-A/C
    Species: Homo sapiens [TaxId:9606]
    Gene: Lamin A/C 435-552, LMN1, LMNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02545 (1-117)
      • expression tag (0)
      • engineered (47)
    Domains in SCOPe 2.08: d3gefb1, d3gefb2
  • Chain 'C':
    Compound: Lamin-A/C
    Species: Homo sapiens [TaxId:9606]
    Gene: Lamin A/C 435-552, LMN1, LMNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02545 (1-117)
      • expression tag (0)
      • engineered (47)
    Domains in SCOPe 2.08: d3gefc1, d3gefc2
  • Chain 'D':
    Compound: Lamin-A/C
    Species: Homo sapiens [TaxId:9606]
    Gene: Lamin A/C 435-552, LMN1, LMNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02545 (1-117)
      • expression tag (0)
      • engineered (47)
    Domains in SCOPe 2.08: d3gefd1, d3gefd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gefA (A:)
    stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
    vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gefB (B:)
    stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
    vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gefC (C:)
    stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
    vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gefD (D:)
    stsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltywfppkftlkagqv
    vtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvved