PDB entry 3ge4

View 3ge4 on RCSB PDB site
Description: Crystal structure of ferritin:DNA-binding protein DPS from Brucella Melitensis
Class: DNA binding protein
Keywords: SSGCID, FERRITIN, DNA-BINDING PROTEIN, DPS, BURKHOLDERIA PSEUDOMALLEI, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, DNA BINDING PROTEIN
Deposited on 2009-02-25, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.145
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4a_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4b_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4c_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4d_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4e_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4f_
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4g_
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4h_
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4i_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4j_
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4k_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1980
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ge4l_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ge4A (A:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4A (A:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ge4B (B:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4B (B:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ge4C (C:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4C (C:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ge4D (D:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4D (D:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ge4E (E:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4E (E:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ge4F (F:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4F (F:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ge4G (G:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4G (G:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ge4H (H:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4H (H:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ge4I (I:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4I (I:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ge4J (J:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4J (J:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3ge4K (K:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4K (K:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ge4L (L:)
    mahhhhhhmpkksmhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfi
    avhemldgfraelddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlva
    lierygdvanlvrksikdaddagdddtadiftaasrsldkalwfleahvqesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ge4L (L:)
    smhatrndlpsntkttmiallnenlaatidlalitkqahwnlkgpqfiavhemldgfrae
    lddhvdtiaeravqiggtaygttqvvvkesrlkpyptdiyavhdhlvalierygdvanlv
    rksikdaddagdddtadiftaasrsldkalwfleahvqesn