PDB entry 3ge2

View 3ge2 on RCSB PDB site
Description: crystal structure of putative lipoprotein sp_0198 from streptococcus pneumoniae
Deposited on 2009-02-24, released 2009-03-17
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein, putative
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: K, CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ge2A (A:)
snaaqqvqqpvaqqqvqqpaqqntntanaggnqnqaapvqnqpvaqptdidgtytgqddg
dritlvvtgttgtwtelesdgdqkvkqvtfdsanqrmiigddvkiytvngnqivvddmdr
dpsdqivltk

    Sequence, based on observed residues (ATOM records):
    >3ge2A (A:)
qpvaqptdidgtytgqddgdritlvvtgttgtwtelesdgdqkvkqvtfdsanqrmiigd
dvkiytvngnqivvddmdrdpsdqivltk