PDB entry 3gdm

View 3gdm on RCSB PDB site
Description: Crystal structure of the K93R mutant of the orotidine 5'-monophosphate decarboxylase from Saccharomyces cerevisiae
Class: lyase
Keywords: orotidine 5'-monophosphate decarboxylase, Saccharomyces cerevisiae, K93R mutant, Decarboxylase, Lyase, Phosphoprotein, Pyrimidine biosynthesis, Ubl conjugation
Deposited on 2009-02-24, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.215
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: URA3, YEL021W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03962
      • engineered (92)
    Domains in SCOPe 2.07: d3gdma_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: URA3, YEL021W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03962
      • engineered (92)
    Domains in SCOPe 2.07: d3gdmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gdmA (A:)
    mskatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
    hvdiltdfsmegtvkplkalsakynfllfedrrfadigntvklqysagvyriaewaditn
    ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvi
    gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
    grdakvegeryrkagweaylrrcgqqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gdmA (A:)
    katykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthv
    diltdfsmegtvkplkalsakynfllfedrrfadigntvklqysagvyriaewaditnah
    gvvgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigf
    iaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfakgr
    dakvegeryrkagweaylrrc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gdmB (B:)
    mskatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
    hvdiltdfsmegtvkplkalsakynfllfedrrfadigntvklqysagvyriaewaditn
    ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvi
    gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
    grdakvegeryrkagweaylrrcgqqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gdmB (B:)
    katykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkthv
    diltdfsmegtvkplkalsakynfllfedrrfadigntvklqysagvyriaewaditnah
    gvvgpgivsglkqaaeevtkeprgllmlaelsckgslatgeytkgtvdiaksdkdfvigf
    iaqrdmggrdegydwlimtpgvglrtvddvvstgsdiiivgrglfakgrdakvegeryrk
    agweaylrr