PDB entry 3gct

View 3gct on RCSB PDB site
Description: structure of gamma-*chymotrypsin in the range $p*h 2.0 to $p*h 10.5 suggests that gamma-chymotrypsin is a covalent acyl-enzyme adduct at low $p*h
Deposited on 1990-09-04, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3gcta_
  • Chain 'E':
    no info in PDB for this chain
  • Chain 'F':
    no info in PDB for this chain
  • Chain 'G':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gctA (A:)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gctA (A:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgv
    sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.