PDB entry 3gci

View 3gci on RCSB PDB site
Description: Crystal Structure of the Complex Formed Between a New Isoform of Phospholipase A2 with C-terminal Amyloid Beta Heptapeptide at 2 A Resolution
Class: hydrolase
Keywords: PHOSPHOLIPASE A2, HEPTAPEPTIDE, AMYLOID BETA, Hydrolase, Lipid degradation, Metal-binding, Secreted
Deposited on 2009-02-22, released 2009-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60045 (0-118)
      • see remark 999 (18)
      • see remark 999 (45)
      • see remark 999 (62)
    Domains in SCOPe 2.08: d3gcia_
  • Chain 'P':
    Compound: Heptapeptide from Amyloid beta A4 protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gciA (A:)
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpkfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

  • Chain 'P':
    No sequence available.