PDB entry 3gcf

View 3gcf on RCSB PDB site
Description: Terminal oxygenase of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177
Class: oxidoreductase
Keywords: rieske oxygenase, 2fe-2s, dioxygenase, carbazole, electron transfer, oxidoreductase
Deposited on 2009-02-22, released 2009-09-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gcfa1, d3gcfa2
  • Chain 'B':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gcfb1, d3gcfb2
  • Chain 'C':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gcfc1, d3gcfc2
  • Chain 'D':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Terminal oxygenase component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAa
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE2, FES, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gcfA (A:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfA (A:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gcfB (B:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfB (B:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gcfC (C:)
    mstsqeisdpaqatssaqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvl
    ltrakgevkaiadgcahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgsp
    vigkigikvypvqvaqgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlg
    vengfdtthifmhrnspwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympv
    featldgetvlsaeltgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqhey
    fqvlqrkvegpedvktfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlf
    ppdmcivkwrtlasergrgvraarvemshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcfC (C:)
    saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
    ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
    qgvvfvfigdeephalsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrn
    spwvsgnrlafpygfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsael
    tgeekkvaaqvsvwlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvk
    tfevefeerwrddalhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlase
    rgrgvra
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.