PDB entry 3gce

View 3gce on RCSB PDB site
Description: Ferredoxin of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177
Class: oxidoreductase
Keywords: rieske ferredoxin, 2fe-2s, dioxygenase, carbazole, electron transfer, oxidoreductase
Deposited on 2009-02-22, released 2009-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin component of carbazole 1,9a-dioxygenase
    Species: Nocardioides aromaticivorans [TaxId:200618]
    Gene: carAc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gcea_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3gceA (A:)
mnrhsagqstpvrvatldqlkpgvptafdvdgdevmvvrdgdsvyaisnlcshaeayldm
gvfhaesleiecplhvgrfdvrtgaptalpcvlpvraydvvvdgteilvapkeadhhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >3gceA (A:)
stpvrvatldqlkpgvptafdvdgdevmvvrdgdsvyaisnlcshaeayldmgvfhaesl
eiecplhvgrfdvrtgaptalpcvlpvraydvvvdgteilvapk