PDB entry 3gcc

View 3gcc on RCSB PDB site
Description: solution structure of the gcc-box binding domain, nmr, 46 structures
Deposited on 1998-03-13, released 1999-03-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: NMR46
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d3gcc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gcc_ (-)
  khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
  lrv