PDB entry 3gc9

View 3gc9 on RCSB PDB site
Description: The structure of p38beta C119S, C162S in complex with a dihydroquinazolinone inhibitor
Class: transferase
Keywords: Serine/Threonine kinase, drug design, selectivity, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-02-21, released 2009-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.224
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 11
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK11, PRKM11, SAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15759
      • engineered (124)
      • engineered (167)
    Domains in SCOPe 2.06: d3gc9a_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 11
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK11, PRKM11, SAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15759
      • engineered (124)
      • engineered (167)
    Domains in SCOPe 2.06: d3gc9b_
  • Heterogens: NA, B45, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gc9A (A:)
    gshmlemsgpragfyrqelnktvwevpqrlqglrpvgsgaygsvcsaydarlrqkvavkk
    lsrpfqsliharrtyrelrllkhlkhenviglldvftpatsiedfsevylvttlmgadln
    nivksqalsdehvqflvyqllrglkyihsagiihrdlkpsnvavnedselrildfglarq
    adeemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaellqgkalfpgsdyidqlkr
    imevvgtpspevlakissehartyiqslppmpqkdlssifrganplaidllgrmlvldsd
    qrvsaaealahayfsqyhdpedepeaepydesveakertleewkeltyqevlsfkppepp
    kppgsleieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gc9A (A:)
    gpragfyrqelnktvwevpqrlqglrpvgsgaygsvcsaydarlrqkvavkklsrpfqsl
    iharrtyrelrllkhlkhenviglldvftpatsiedfsevylvttlmgadlnnivksqal
    sdehvqflvyqllrglkyihsagiihrdlkpsnvavnedselrildfglaatrwyrapei
    mlnwmhynqtvdiwsvgcimaellqgkalfpgsdyidqlkrimevvgtpspevlakisse
    hartyiqslppmpqkdlssifrganplaidllgrmlvldsdqrvsaaealahayfsqyhd
    pedepeaepydesveakertleewkeltyqevlsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gc9B (B:)
    gshmlemsgpragfyrqelnktvwevpqrlqglrpvgsgaygsvcsaydarlrqkvavkk
    lsrpfqsliharrtyrelrllkhlkhenviglldvftpatsiedfsevylvttlmgadln
    nivksqalsdehvqflvyqllrglkyihsagiihrdlkpsnvavnedselrildfglarq
    adeemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaellqgkalfpgsdyidqlkr
    imevvgtpspevlakissehartyiqslppmpqkdlssifrganplaidllgrmlvldsd
    qrvsaaealahayfsqyhdpedepeaepydesveakertleewkeltyqevlsfkppepp
    kppgsleieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gc9B (B:)
    sgpragfyrqelnktvwevpqrlqglrpvgsgaygsvcsaydarlrqkvavkklsrpfqs
    liharrtyrelrllkhlkhenviglldvftpatsiedfsevylvttlmgadlnnivksqa
    lsdehvqflvyqllrglkyihsagiihrdlkpsnvavnedselrildfglarvatrwyra
    peimlnwmhynqtvdiwsvgcimaellqgkalfpgsdyidqlkrimevvgtpspevlaki
    ssehartyiqslppmpqkdlssifrganplaidllgrmlvldsdqrvsaaealahayfsq
    yhdpedepeaepydesveakertleewkeltyqevlsfk