PDB entry 3gc3

View 3gc3 on RCSB PDB site
Description: Crystal Structure of Arrestin2S and Clathrin
Class: endocytosis
Keywords: protein-protein complex, Phosphoprotein, Sensory transduction, Coated pit, Cytoplasmic vesicle, Membrane, ENDOCYTOSIS
Deposited on 2009-02-21, released 2009-08-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-arrestin-1
    Species: Bos taurus [TaxId:9913]
    Gene: ARRB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gc3a1, d3gc3a2
  • Chain 'B':
    Compound: Clathrin heavy chain 1
    Species: Bos taurus [TaxId:9913]
    Gene: CLTC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gc3b1, d3gc3b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gc3A (A:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggdvavelpftlmhpkpkeepphrevpeh
    etpvdtnlieldtndddivfedfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gc3A (A:)
    gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvrrvyvtltcafryggltfrkd
    lfvanvqsfppkpltrlqerlikklgehaypftfeippnlpcsvtlqacgvdyevkafca
    enleekihkrnsvrlvirkvqyaperpgpqptaettrqflmsdkplhleasldkeiyyhg
    episvnvhvtnntnktvkkikisvrqyadiclfntaqykcpvameeaddtvapsstfckv
    ytltpflakrglaldgklkhedtnlasstllreganreilgiivsykvkvklvvsrggdv
    avelpftlmhpkpkdtnlieldivfedfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gc3B (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gc3B (B:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekgaqvviidmndpsnpirrp
    isadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvtdn
    avyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqrvvgamqlysvd
    rkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpfpkka
    vdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgetifvta
    pheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnn