PDB entry 3gbw

View 3gbw on RCSB PDB site
Description: crystal structure of the first phr domain of the mouse myc-binding protein 2 (mycbp-2)
Deposited on 2009-02-20, released 2009-03-24
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase MYCBP2
    Species: Mus musculus [TaxId:10090]
    Gene: Mycbp2, Pam, Rpm-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7TPH6 (2-End)
      • expression tag (0-1)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gbwA (A:)
sledysvvnrfeshgggwgysahsveairfsadtdillgglglfggrgeytakiklfelg
pdggdhetdgdllaetdvlaydcaarekyammfdepvllqagwwyvawarvsgpssdcgs
hgqasittddgvifqfksskksnngtdvnagqipqllyrlptsd

    Sequence, based on observed residues (ATOM records):
    >3gbwA (A:)
sledysvvnrfeshgggwgysahsveairfsadtdillgglglfggrgeytakiklfelg
pdggdhetdgdllaetdvlaydcaarekyammfdepvllqagwwyvawarvsgpssdcgs
hgqasittddgvifqfksskksnngtdvnagqipqllyrlp