PDB entry 3gbv

View 3gbv on RCSB PDB site
Description: Crystal structure of a putative LacI transcriptional regulator from Bacteroides fragilis
Class: transcription regulator
Keywords: NYSGXRC, PSI-II, 11231j, transcriptional regulator, Structural Genomics, Protein Structure Initiative, New York Structural GenomiX Research Consortium, DNA-binding, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR, New York SGX Research Center for Structural Genomics
Deposited on 2009-02-20, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative LacI-family transcriptional regulator
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: BF2720
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gbva_
  • Chain 'B':
    Compound: Putative LacI-family transcriptional regulator
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: BF2720
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gbvb_
  • Heterogens: EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gbvA (A:)
    mslasnkkytfacllpkhlegeywtdvqkgireavttysdfnisanithydpydynsfva
    tsqavieeqpdgvmfaptvpqytkgftdalnelgipyiyidsqikdapplaffgqnshqs
    gyfaarmlmllavndreivifrkihegvigsnqqesreigfrqymqehhpacnilelnlh
    adlniedsrmlddffrehpdvkhgitfnskvyiigeylqqrrksdfsligydllernvtc
    lkegtvsfliaqqpelqgfnsiktlcdhlifrkevactnympidlltkenidyyhseghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gbvA (A:)
    kkytfacllpkhlegeywtdvqkgireavttysdfnisanithydpydynsfvatsqavi
    eeqpdgvmfaptvpqytkgftdalnelgipyiyidsqikdapplaffgqnshqsgyfaar
    mlmllavndreivifrkihegvigsnqqesreigfrqymqehhpacnilelnlhadlnie
    dsrmlddffrehpdvkhgitfnskvyiigeylqqrrksdfsligydllernvtclkegtv
    sfliaqqpelqgfnsiktlcdhlifrkevactnympidlltkenidyyh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gbvB (B:)
    mslasnkkytfacllpkhlegeywtdvqkgireavttysdfnisanithydpydynsfva
    tsqavieeqpdgvmfaptvpqytkgftdalnelgipyiyidsqikdapplaffgqnshqs
    gyfaarmlmllavndreivifrkihegvigsnqqesreigfrqymqehhpacnilelnlh
    adlniedsrmlddffrehpdvkhgitfnskvyiigeylqqrrksdfsligydllernvtc
    lkegtvsfliaqqpelqgfnsiktlcdhlifrkevactnympidlltkenidyyhseghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gbvB (B:)
    kkytfacllpkhlegeywtdvqkgireavttysdfnisanithydpydynsfvatsqavi
    eeqpdgvmfaptvpqytkgftdalnelgipyiyidsqikdapplaffgqnshqsgyfaar
    mlmllavndreivifrkihegvigsnqqesreigfrqymqehhpacnilelnlhadleds
    rmlddffrehpdvkhgitfnskvyiigeylqqrrksdfsligydllernvtclkegtvsf
    liaqqpelqgfnsiktlcdhlifrkevactnympidlltkenidyyh