PDB entry 3gbk

View 3gbk on RCSB PDB site
Description: Crystal Structure of Human PPAR-gamma Ligand Binding Domain Complexed with a Potent and Selective Agonist
Class: ligand binding protein
Keywords: PPAR aganists, x-ray co-crystal analysis, Structure-based drug design, selective, Type II Diabetes, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, ligand binding protein
Deposited on 2009-02-19, released 2009-12-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPAR gamma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gbka_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPAR gamma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gbkb_
  • Heterogens: 2PQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gbkA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gbkB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly