PDB entry 3gb3

View 3gb3 on RCSB PDB site
Description: X-ray structure of genetically encoded photosensitizer KillerRed in native form
Class: fluorescent protein
Keywords: Fluorescent protein, genetically encoded photosensitizer, KillerRed, phototoxicity
Deposited on 2009-02-18, released 2009-09-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gb3a_
  • Chain 'B':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gb3b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gb3A (A:)
    meggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpi
    chliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsr
    itvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdsk
    mtfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gb3A (A:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gb3B (B:)
    meggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpi
    chliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsr
    itvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdsk
    mtfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gb3B (B:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig