PDB entry 3gb2

View 3gb2 on RCSB PDB site
Description: GSK3beta inhibitor complex
Class: transferase
Keywords: protein kinase, inhibitor, complex, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway, CDM
Deposited on 2009-02-18, released 2010-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B, GSK3beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gb2a_
  • Heterogens: G3B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gb2A (A:)
    gamgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqd
    krfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrak
    qtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrg
    epnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveii
    kvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarlt
    pleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gb2A (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssevylnlvldyvpetvyrvarhysrakqtlpviyvk
    lymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyics
    ryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptre
    qiremnpefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde
    lrdpnvklpngrdtpalfnfttqelssnpplatilipphar