PDB entry 3gb1

View 3gb1 on RCSB PDB site
Description: structures of b1 domain of streptococcal protein g
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1999-05-02, released 1999-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (b1 domain of streptococcal protein g)
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GB1 (0-55)
    Domains in SCOPe 2.07: d3gb1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gb1A (A:)
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte