PDB entry 3gb1

View 3gb1 on RCSB PDB site
Description: structures of b1 domain of streptococcal protein g
Deposited on 1999-05-02, released 1999-06-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-23, with a file datestamp of 1999-06-22.
Experiment type: NMR32
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d3gb1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gb1A (A:)
    mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte