PDB entry 3gat

View 3gat on RCSB PDB site
Description: solution nmr structure of the c-terminal domain of chicken gata-1 bound to DNA, 34 structures
Class: transcription/DNA
Keywords: DNA-binding protein, transcription factor, zinc binding domain, tcomplex (transcription regulation/DNA)
Deposited on 1997-11-07, released 1998-01-28
The last revision prior to the SCOP 1.75 freeze date was dated 1998-01-28, with a file datestamp of 2007-06-04.
Experiment type: NMR34
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: erythroid transcription factor gata-1
  Species: GALLUS GALLUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17678 (0-65)
  Domains in SCOP 1.75: d3gata_
• Chain 'B':
  Compound: DNA (5'-d(*gp*tp*tp*gp*cp*ap*gp*ap*tp*ap*ap*ap*cp*ap*tp*t)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*ap*ap*tp*gp*tp*tp*tp*ap*tp*cp*tp*gp*cp*ap*ap*c)-3')
  
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gatA (A:)
  kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss
  kgkkrr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.