PDB entry 3gar

View 3gar on RCSB PDB site
Description: a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase
Deposited on 1998-05-13, released 1998-08-12
The last revision prior to the SCOP 1.55 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d3gar__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gar_ (-)
  mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
  fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
  hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
  iswfadgrlkmhenaawldgqrlppqgya