PDB entry 3gan

View 3gan on RCSB PDB site
Description: Crystal structure of gene product from Arabidopsis thaliana At3g22680 with bound suramin
Class: structural genomics, unknown function
Keywords: suramin, Structural Genomics Functional Follow-Up Study, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2009-02-17, released 2009-03-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein At3g22680
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At3g22680, At3g22680.1, MWI23.5, Q9LUJ3, Y3268_ARATH
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LUJ3
  Domains in SCOPe 2.03: d3gana_
• Heterogens: SVR, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3ganA (A:)
  selrpsgdsgssdvdaeisdgfspldtshrdvadegsllrraemyqdymkqvpiptnrgs
  lipftswvglsismkqlygqplhyltnvllqrwdqsrfgtdseeqrldsiihptkaeati
  wlveeihrltpshlhmallwrsdpmyhsfidpifpek
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ganA (A:)
  sllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdqs
  rfqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp