PDB entry 3gal

View 3gal on RCSB PDB site
Description: crystal structure of human galectin-7 in complex with galactosamine
Deposited on 1998-07-13, released 1998-11-04
The last revision prior to the SCOP 1.63 freeze date was dated 1998-11-04, with a file datestamp of 1998-11-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d3gala_
  • Chain 'B':
    Domains in SCOP 1.63: d3galb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3galA (A:)
    nvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvf
    nskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlv
    evggdvqldsvrif
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3galB (B:)
    snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
    fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
    vevggdvqldsvrif